PDB entry 4om0

View 4om0 on RCSB PDB site
Description: Crystal structure of antibody VRC07-G54Y in complex with clade A/E 93TH057 HIV-1 gp120 core
Class: viral protein/immune system
Keywords: VRC07 antibody, Passive transfer, Neutralization, In vivo protection, Autoreactivity, Lentiviral infection, Enhanced potency, HIV-1 gp120, VRC07-G54Y, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2014-01-25, released 2014-09-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-02, with a file datestamp of 2021-05-28.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: envelope glycoprotein gp160
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: Env, pol
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Antigen binding fragment of heavy chain: Antibody VRC01
    Species: Homo sapiens [TaxId:9606]
    Gene: Heavy chain
    Database cross-references and differences (RAF-indexed):
    • PDB 4OM0 (0-227)
  • Chain 'L':
    Compound: Antigen binding fragment of light chain: Antibody VRC01
    Species: Homo sapiens [TaxId:9606]
    Gene: Light chain
    Database cross-references and differences (RAF-indexed):
    • PDB 4OM0 (Start-209)
    Domains in SCOPe 2.08: d4om0l1, d4om0l2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >4om0L (L:)
eivltqspgtlslspgetaiiscrtsqygslawyqqrpgqaprlviysgstraagipdrf
sgsrwgpdynltisnlesgdfgvyycqqyeffgqgtkvqvdikrtvaapsvfifppsdeq
lksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlska
dyekhkvyacevthqglsspvtksfnrgec

    Sequence, based on observed residues (ATOM records): (download) 
    >4om0L (L:)
vltqspgtlslspgetaiiscrtsqygslawyqqrpgqaprlviysgstraagipdrfsg
srwgpdynltisnlesgdfgvyycqqyeffgqgtkvqvdikrtvaapsvfifppsdeqlk
sgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskady
ekhkvyacevthqglsspvtksfnrgec