PDB entry 4olt

View 4olt on RCSB PDB site
Description: Chitosanase complex structure
Class: hydrolase
Keywords: chitosanase, Glycoside hydrolase, chitosan, HYDROLASE
Deposited on 2014-01-25, released 2014-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.164
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitosanase
    Species: Pseudomonas sp. LL2(2010) [TaxId:878476]
    Gene: CHI, chitosanase OU01
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1AXU1 (Start-247)
      • see remark 999 (75)
      • see remark 999 (98)
      • see remark 999 (244)
    Domains in SCOPe 2.07: d4olta_
  • Chain 'B':
    Compound: Chitosanase
    Species: Pseudomonas sp. LL2(2010) [TaxId:878476]
    Gene: CHI, chitosanase OU01
    Database cross-references and differences (RAF-indexed):
    • Uniprot E1AXU1 (Start-247)
      • see remark 999 (75)
      • see remark 999 (98)
      • see remark 999 (244)
    Domains in SCOPe 2.07: d4oltb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oltA (A:)
    gplgspefetagtvdldapvqkdtamslvssfensstdwqaqygylediadgrgytggli
    gftsgtgdmlelvraysasspgnpleqyipaleavngtdshaglgqgfeqawadaaetse
    fraaqdaerdrvyfdpavaqgkadglsalgqfayydtlvvhgpgsqrdafggiraealsa
    alppsqggdeteyleaffdarnvimreepahadtsridtaqrvflqngnfdlerpltwsv
    ygdqysln
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oltA (A:)
    tvdldapvqkdtamslvssfensstdwqaqygylediadgrgytggligftsgtgdmlel
    vraysasspgnpleqyipaleavngtdshaglgqgfeqawadaaetsefraaqdaerdrv
    yfdpavaqgkadglsalgqfayydtlvvhgpgsqrdafggiraealsaalppsqggdete
    yleaffdarnvimreepahadtsridtaqrvflqngnfdlerpltwsvygdqysln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oltB (B:)
    gplgspefetagtvdldapvqkdtamslvssfensstdwqaqygylediadgrgytggli
    gftsgtgdmlelvraysasspgnpleqyipaleavngtdshaglgqgfeqawadaaetse
    fraaqdaerdrvyfdpavaqgkadglsalgqfayydtlvvhgpgsqrdafggiraealsa
    alppsqggdeteyleaffdarnvimreepahadtsridtaqrvflqngnfdlerpltwsv
    ygdqysln
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oltB (B:)
    gtvdldapvqkdtamslvssfensstdwqaqygylediadgrgytggligftsgtgdmle
    lvraysasspgnpleqyipaleavngtdshaglgqgfeqawadaaetsefraaqdaerdr
    vyfdpavaqgkadglsalgqfayydtlvvhgpgsqrdafggiraealsaalppsqggdet
    eyleaffdarnvimreepahadtsridtaqrvflqngnfdlerpltwsvygdqysln