PDB entry 4olb

View 4olb on RCSB PDB site
Description: Crystal Structure of Human Argonaute2 Bound to Tryptophan
Class: hydrolase/RNA
Keywords: RNA-binding protein, RNA interference, protein-RNA complex, ago, HYDROLASE-RNA complex
Deposited on 2014-01-23, released 2014-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.212
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein argonaute-2
    Species: Homo sapiens [TaxId:9606]
    Gene: EIF2C2, AGO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UKV8 (Start-858)
      • engineered mutation (386)
    Domains in SCOPe 2.07: d4olba1, d4olba2, d4olba3
  • Chain 'B':
    Compound: 5'-r(p*ap*ap*ap*ap*ap*ap*ap*ap*ap*u)-3'
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4olbA (A:)
    mysgagpalappappppiqgyafkppprpdfgtsgrtiklqanffemdipkidiyhyeld
    ikpekcprrvnreivehmvqhfktqifgdrkpvfdgrknlytamplpigrdkvelevtlp
    gegkdrifkvsikwvscvslqalhdalsgrlpsvpfetiqaldvvmrhlpsmrytpvgrs
    fftasegcsnplgggrevwfgfhqsvrpslwkmmlnidvsatafykaqpviefvcevldf
    ksieeqqkpltdsqrvkftkeikglkveithcgqmkrkyrvcnvtrrpashqtfplqqes
    gqtvectvaqyfkdrhklvlryphlpclqvgqeqkhtylplevcnivagqrcikkltdnq
    tstmiratarsapdrqeeisklmrsadfntdpyvrefgimvkdemtdvtgrvlqppsily
    ggrnkaiatpvqgvwdmrnkqfhtgieikvwaiacfapqrqctevhlksfteqlrkisrd
    agmpiqgqpcfckyaqgadsvepmfrhlkntyaglqlvvvilpgktpvyaevkrvgdtvl
    gmatqcvqmknvqrttpqtlsnlclkinvklggvnnillpqgrppvfqqpviflgadvth
    ppagdgkkpsiaavvgsmdahpnrycatvrvqqhrqeiiqdlaamvrelliqfykstrfk
    ptriifyrdgvsegqfqqvlhhellaireaciklekdyqpgitfivvqkrhhtrlfctdk
    nervgksgnipagttvdtkithptefdfylcshagiqgtsrpshyhvlwddnrfssdelq
    iltyqlchtyvrctrsvsipapayyahlvafraryhlvdkehdsaegshtsgqsngrdhq
    alakavqvhqdtlrtmyfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4olbA (A:)
    afkppprpdfgtsgrtiklqanffemdipkidiyhyeldikpekcprrvnreivehmvqh
    fktqifgdrkpvfdgrknlytamplpigrdkvelevtlrifkvsikwvscvslqalhdal
    sgrlvpfetiqaldvvmrhlpsmrytpvgrsfftassnplgggrevwfgfhqsvrpslwk
    mmlnidvsatafykaqpviefvcevldfksieqkpltdsqrvkftkeikglkveithkrk
    yrvcnvtrrpashqtfplqqesgqtvectvaqyfkdrhklvlryphlpclqvgqehtylp
    levcnivagqrcikkltdnqtstmiratarsapdrqeeisklmrsadfntdpyvrefgim
    vkdemtdvtgrvlqppsilyggrnkaiatpvqgvwdmrnkqfhtgieikvwaiacfapqr
    qctevhlksfteqlrkisrdagmpiqgqpcfckyaqgadsvepmfrhlkntyaglqlvvv
    ilpgktpvyaevkrvgdtvlgmatqcvqmknvqrttpqtlsnlclkinvklggvnnillp
    qgrppvfqqpviflgadvthppkkpsiaavvgsmdahpnrycatvrvqqhrqeiiqdlaa
    mvrelliqfykstrfkptriifyrdgvsegqfqqvlhhellaireaciklekdyqpgitf
    ivvqkrhhtrlfctdknervgksgnipagttvdtkithptefdfylcshagiqgtsrpsh
    yhvlwddnrfssdelqiltyqlchtyvrctrsvsipapayyahlvafraryhlvqalaka
    vqvhqdtlrtmyfa
    

  • Chain 'B':
    No sequence available.