PDB entry 4ol7

View 4ol7 on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS V66E A109E at cryogenic temperature
Class: hydrolase
Keywords: nuclease, pdTp, pH-sensitive switch, internal ionizable groups, HYDROLASE
Deposited on 2014-01-23, released 2015-01-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.159
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-End)
      • engineered mutation (43-44)
      • engineered mutation (59)
      • engineered mutation (102)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.05: d4ol7a_
  • Chain 'B':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (43-44)
      • engineered mutation (59)
      • engineered mutation (102)
      • engineered mutation (110)
      • engineered mutation (117)
      • engineered mutation (121)
    Domains in SCOPe 2.05: d4ol7b_
  • Heterogens: THP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ol7A (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkme
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglekvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ol7A (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkme
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglekvayvykgnntheqllr
    kaeaqakkeklniwse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ol7B (B:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkme
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglekvayvykgnntheqllr
    kaeaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ol7B (B:)
    kklhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmeenak
    kievefdkgqrtdkygrglayiyadgkmvnealvrqglekvayvykgnntheqllrkaea
    qakkeklniwse