PDB entry 4ojt

View 4ojt on RCSB PDB site
Description: Helicobacter pylori MTAN complexed with S-ribosylhomocysteine and adenine
Class: Hydrolase
Keywords: Homodimer, Hydrolase
Deposited on 2014-01-21, released 2014-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.183
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MTA/SAH nucleosidase
    Species: Helicobacter pylori [TaxId:85963]
    Gene: jhp_0082, mtn, mtnN, Pfs
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZMY2 (2-230)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d4ojta1, d4ojta2
  • Heterogens: 2WP, ADE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ojtA (A:)
mgqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstl
tttsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesai
fietsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasv
afvcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel