PDB entry 4oj4

View 4oj4 on RCSB PDB site
Description: Crystal structure of V290M PPARgamma mutant in complex with diclofenac
Class: transcription
Keywords: Mainly alpha helix, Nuclear receptor, Transcription factor, RXR, TRANSCRIPTION
Deposited on 2014-01-20, released 2015-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-04, with a file datestamp of 2015-01-30.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.222
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (Start-277)
      • engineered mutation (90)
    Domains in SCOPe 2.07: d4oj4a_
  • Heterogens: DIF, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oj4A (A:)
    gshmlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmge
    dkikfkhitplqeqskevairifqgcqfrsmeavqeiteyaksipgfvnldlndqvtllk
    ygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalel
    ddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkm
    tdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oj4A (A:)
    esadlralakhlydsyiksfpltkakarailtgktkspfviydmnslmmgedkieqskev
    airifqgcqfrsmeavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkd
    gvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdr
    pgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvik
    ktetdmslhpllqeiykdly