PDB entry 4oj0

View 4oj0 on RCSB PDB site
Description: mCardinal V218E
Class: fluorescent protein
Keywords: fluorescent protein
Deposited on 2014-01-20, released 2014-03-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.165
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorescent protein FP480
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0VX33 (8-End)
      • expression tag (7)
      • conflict (11)
      • conflict (15)
      • conflict (33)
      • conflict (66)
      • chromophore (68)
      • conflict (72)
      • conflict (76)
      • conflict (78-79)
      • conflict (85)
      • conflict (109)
      • conflict (126)
      • conflict (148)
      • conflict (151)
      • conflict (163)
      • conflict (165)
      • conflict (170)
      • conflict (176)
      • conflict (179)
      • conflict (190)
      • conflict (199)
      • conflict (202)
      • conflict (212)
      • engineered mutation (223)
    Domains in SCOPe 2.06: d4oj0a1, d4oj0a2
  • Chain 'B':
    Compound: Fluorescent protein FP480
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0VX33 (8-End)
      • expression tag (7)
      • conflict (11)
      • conflict (15)
      • conflict (33)
      • conflict (66)
      • chromophore (68)
      • conflict (72)
      • conflict (76)
      • conflict (78-79)
      • conflict (85)
      • conflict (109)
      • conflict (126)
      • conflict (148)
      • conflict (151)
      • conflict (163)
      • conflict (165)
      • conflict (170)
      • conflict (176)
      • conflict (179)
      • conflict (190)
      • conflict (199)
      • conflict (202)
      • conflict (212)
      • engineered mutation (223)
    Domains in SCOPe 2.06: d4oj0b1, d4oj0b2
  • Chain 'C':
    Compound: Fluorescent protein FP480
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0VX33 (8-End)
      • expression tag (7)
      • conflict (11)
      • conflict (15)
      • conflict (33)
      • conflict (66)
      • chromophore (68)
      • conflict (72)
      • conflict (76)
      • conflict (78-79)
      • conflict (85)
      • conflict (109)
      • conflict (126)
      • conflict (148)
      • conflict (151)
      • conflict (163)
      • conflict (165)
      • conflict (170)
      • conflict (176)
      • conflict (179)
      • conflict (190)
      • conflict (199)
      • conflict (202)
      • conflict (212)
      • engineered mutation (223)
    Domains in SCOPe 2.06: d4oj0c1, d4oj0c2
  • Chain 'D':
    Compound: Fluorescent protein FP480
    Species: Entacmaea quadricolor [TaxId:6118]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0VX33 (8-End)
      • expression tag (7)
      • conflict (11)
      • conflict (15)
      • conflict (33)
      • conflict (66)
      • chromophore (68)
      • conflict (72)
      • conflict (76)
      • conflict (78-79)
      • conflict (85)
      • conflict (109)
      • conflict (126)
      • conflict (148)
      • conflict (151)
      • conflict (163)
      • conflict (165)
      • conflict (170)
      • conflict (176)
      • conflict (179)
      • conflict (190)
      • conflict (199)
      • conflict (202)
      • conflict (212)
      • engineered mutation (223)
    Domains in SCOPe 2.06: d4oj0d1, d4oj0d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oj0A (A:)
    dpmvskgeelikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfa
    fdilatcfmygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgc
    liynvklrgvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnl
    kttyrskkpagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpsklghklng
    mdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oj0A (A:)
    eelikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatc
    fmygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvkl
    rgvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnlkttyrsk
    kpagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpskl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oj0B (B:)
    dpmvskgeelikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfa
    fdilatcfmygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgc
    liynvklrgvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnl
    kttyrskkpagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpsklghklng
    mdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oj0B (B:)
    eelikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatc
    fmygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvkl
    rgvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnlkttyrsk
    kpagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpskl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4oj0C (C:)
    dpmvskgeelikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfa
    fdilatcfmygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgc
    liynvklrgvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnl
    kttyrskkpagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpsklghklng
    mdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oj0C (C:)
    eelikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatc
    fmygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvkl
    rgvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnlkttyrsk
    kpagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpskl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4oj0D (D:)
    dpmvskgeelikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfa
    fdilatcfmygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgc
    liynvklrgvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnl
    kttyrskkpagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpsklghklng
    mdelyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oj0D (D:)
    eelikenmpmklymegtvnnhhfkcttegegkpyegtqtqrikvveggplpfafdilatc
    fmygsktfikhpkgipdffkqsfpegftwervttyedggvltvtqdtslqdgcliynvkl
    rgvnfpsngpvmqkktlgweattetlypadgglegrcdmalkldggghlhcnlkttyrsk
    kpagnlkmpgvyfvdrrlerikeadnetyveqhevaearycdlpskl