PDB entry 4oit

View 4oit on RCSB PDB site
Description: Structure, interactions and evolutionary implications of a domain-swapped lectin dimer from Mycobacterium smegmatis
Class: sugar binding protein
Keywords: Beta-prism II fold, bacterial lectin, protein-carbohydrate interactions, Beta-Prism II, Carbohydrate binding, Carbohydrate/Sugar, SUGAR BINDING PROTEIN
Deposited on 2014-01-20, released 2014-07-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.222
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LysM domain protein
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Gene: MSMEG_3662
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QYH7 (Start-104)
      • expression tag (105-106)
    Domains in SCOPe 2.05: d4oita_
  • Chain 'B':
    Compound: LysM domain protein
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Gene: MSMEG_3662
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QYH7 (Start-104)
      • expression tag (105-107)
    Domains in SCOPe 2.05: d4oitb_
  • Chain 'C':
    Compound: LysM domain protein
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Gene: MSMEG_3662
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QYH7 (Start-104)
      • expression tag (105-106)
    Domains in SCOPe 2.05: d4oitc_
  • Chain 'D':
    Compound: LysM domain protein
    Species: MYCOBACTERIUM SMEGMATIS [TaxId:246196]
    Gene: MSMEG_3662
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0QYH7 (Start-104)
      • expression tag (105-106)
    Domains in SCOPe 2.05: d4oitd_
  • Heterogens: MAN, BMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oitA (A:)
    mgdtltagqklerggslqsgngaytltlqddgnlvlyardkavwstgtngqdvvraevqt
    dgnfvlytaekpvwhtdtkgkkevklvlqddrnlvlyakdgpawslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oitA (A:)
    gdtltagqklerggslqsgngaytltlqddgnlvlyardkavwstgtngqdvvraevqtd
    gnfvlytaekpvwhtdtkgkkevklvlqddrnlvlyakdgpawsle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oitB (B:)
    mgdtltagqklerggslqsgngaytltlqddgnlvlyardkavwstgtngqdvvraevqt
    dgnfvlytaekpvwhtdtkgkkevklvlqddrnlvlyakdgpawslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oitB (B:)
    gdtltagqklerggslqsgngaytltlqddgnlvlyardkavwstgtngqdvvraevqtd
    gnfvlytaekpvwhtdtkgkkevklvlqddrnlvlyakdgpawsleh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4oitC (C:)
    mgdtltagqklerggslqsgngaytltlqddgnlvlyardkavwstgtngqdvvraevqt
    dgnfvlytaekpvwhtdtkgkkevklvlqddrnlvlyakdgpawslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oitC (C:)
    gdtltagqklerggslqsgngaytltlqddgnlvlyardkavwstgtngqdvvraevqtd
    gnfvlytaekpvwhtdtkgkkevklvlqddrnlvlyakdgpawsle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4oitD (D:)
    mgdtltagqklerggslqsgngaytltlqddgnlvlyardkavwstgtngqdvvraevqt
    dgnfvlytaekpvwhtdtkgkkevklvlqddrnlvlyakdgpawslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oitD (D:)
    gdtltagqklerggslqsgngaytltlqddgnlvlyardkavwstgtngqdvvraevqtd
    gnfvlytaekpvwhtdtkgkkevklvlqddrnlvlyakdgpawsle