PDB entry 4ohs

View 4ohs on RCSB PDB site
Description: The structure of a far-red fluorescent protein, AQ143
Class: fluorescent protein
Keywords: far-red, Beta Barrel, Red Fluorescent Protein, RFP, FLUORESCENT PROTEIN
Deposited on 2014-01-17, released 2014-02-26
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.191
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: far-red fluorescent protein aq143
    Species: Actinia equina [TaxId:6106]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OHS
    Domains in SCOPe 2.03: d4ohsa_
  • Chain 'B':
    Compound: far-red fluorescent protein aq143
    Species: Actinia equina [TaxId:6106]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OHS (Start-241)
  • Chain 'C':
    Compound: far-red fluorescent protein aq143
    Species: Actinia equina [TaxId:6106]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OHS
  • Chain 'D':
    Compound: far-red fluorescent protein aq143
    Species: Actinia equina [TaxId:6106]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OHS
  • Chain 'E':
    Compound: far-red fluorescent protein aq143
    Species: Actinia equina [TaxId:6106]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OHS
  • Chain 'F':
    Compound: far-red fluorescent protein aq143
    Species: Actinia equina [TaxId:6106]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OHS (Start-241)
  • Chain 'G':
    Compound: far-red fluorescent protein aq143
    Species: Actinia equina [TaxId:6106]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OHS
  • Chain 'H':
    Compound: far-red fluorescent protein aq143
    Species: Actinia equina [TaxId:6106]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OHS
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ohsA (A:)
    mhhhhhhgsgaplvtedmcikmtmegtinghhfkcvgegegkpfegtqvekiriteggpl
    pfaydilapccmygmygsktfikhvsgipdyfkesfpegftwertqifedggsltihqdt
    slqgnnfifkvnviganfpangpvmqkktagwepsveilyprdgvlcgqalmalkctdgd
    hltshlrttyrsrkpsnavnmpefhfgdhrieilkaeqgkfyeqyesavaryceaapskl
    gh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ohsA (A:)
    gaplvtedmcikmtmegtinghhfkcvgegegkpfegtqvekiriteggplpfaydilap
    ccmygmygsktfikhvsgipdyfkesfpegftwertqifedggsltihqdtslqgnnfif
    kvnviganfpangpvmqkktagwepsveilyprdgvlcgqalmalkctdgdhltshlrtt
    yrsrkpsnavnmpefhfgdhrieilkaeqgkfyeqyesavaryce
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.