PDB entry 4ohq

View 4ohq on RCSB PDB site
Description: Crystal structure of chloroplast triose phosphate isomerase from Arabidopsis thaliana
Class: isomerase
Keywords: TIM Barrel, chloroplast, ISOMERASE
Deposited on 2014-01-17, released 2015-01-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-01-28, with a file datestamp of 2015-01-23.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.172
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triosephosphate isomerase, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: TIM, At2g21170, F26H11.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ohqa_
  • Chain 'B':
    Compound: Triosephosphate isomerase, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: TIM, At2g21170, F26H11.7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ohqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ohqA (A:)
    magsgkffvggnwkcngtkdsiaklisdlnsatleadvdvvvsppfvyidqvkssltdri
    disgqnswvgkggaftgeisveqlkdlgckwvilghserrhvigekdefigkkaayalse
    glgviacigekleereagktfdvcfaqlkafadavpswdnivvayepvwaigtgkvaspq
    qaqevhvavrgwlkknvseevasktriiyggsvnggnsaelakeedidgflvggaslkgp
    efativnsvtskkvaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ohqA (A:)
    gkffvggnwkcngtkdsiaklisdlnsatleadvdvvvsppfvyidqvkssltdridisg
    qnswvgkggaftgeisveqlkdlgckwvilghserrhvigekdefigkkaayalseglgv
    iacigekleereagktfdvcfaqlkafadavpswdnivvayepvwaigtgkvaspqqaqe
    vhvavrgwlkknvseevasktriiyggsvnggnsaelakeedidgflvggaslkgpefat
    ivnsvtskkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ohqB (B:)
    magsgkffvggnwkcngtkdsiaklisdlnsatleadvdvvvsppfvyidqvkssltdri
    disgqnswvgkggaftgeisveqlkdlgckwvilghserrhvigekdefigkkaayalse
    glgviacigekleereagktfdvcfaqlkafadavpswdnivvayepvwaigtgkvaspq
    qaqevhvavrgwlkknvseevasktriiyggsvnggnsaelakeedidgflvggaslkgp
    efativnsvtskkvaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ohqB (B:)
    sgkffvggnwkcngtkdsiaklisdlnsatleadvdvvvsppfvyidqvkssltdridis
    gqnswvgkggaftgeisveqlkdlgckwvilghserrhvigekdefigkkaayalseglg
    viacigekleereagktfdvcfaqlkafadavpswdnivvayepvwaigtgkvaspqqaq
    evhvavrgwlkknvseevasktriiyggsvnggnsaelakeedidgflvggaslkgpefa
    tivnsvtskkv