PDB entry 4ohj

View 4ohj on RCSB PDB site
Description: Crystal structure of toxic shock syndrome toxin-1 (TSST-1) from Staphylococcus aureus
Class: toxin
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, TOXIN
Deposited on 2014-01-17, released 2014-02-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.143
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: tst
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06886 (Start-212)
      • expression tag (213)
  • Chain 'B':
    Compound: toxic shock syndrome toxin-1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: tst
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06886 (Start-212)
      • expression tag (213-214)
    Domains in SCOPe 2.03: d4ohjb1, d4ohjb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ohjB (B:)
    tdftpvplssnqiiktakastndnikdlldwyssgsdtftnsevldnslgsmrikntdgs
    isliifpspyyspaftkgekvdlntkrtkksqhtsegtyihfqisgvtnteklptpielp
    lkvkvhgkdsplkygpkfdkkqlaistldfeirhqltqihglyrssdktggywkitmndg
    styqsdlskkfeyntekppinideiktieaeingenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ohjB (B:)
    astndnikdlldwyssgsdtftnsevldnslgsmrikntdgsisliifpspyyspaftkg
    ekvdlntkrtkksqhtsegtyihfqisgvtnteklptpielplkvkvhgkdsplkygpkf
    dkkqlaistldfeirhqltqihglyrssdktggywkitmndgstyqsdlskkfeyntekp
    pinideiktieaeinge