PDB entry 4ohh

View 4ohh on RCSB PDB site
Description: LEOPARD Syndrome-Associated SHP2/Q506P mutant
Class: hydrolase
Keywords: sh2 domain, phosphatase domain, hydrolase
Deposited on 2014-01-17, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.206
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase non-receptor type 11
    Species: Homo sapiens [TaxId:9606]
    Gene: PTP2C, PTPN11, SHPTP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06124 (Start-527)
      • engineered mutation (505)
    Domains in SCOPe 2.07: d4ohha1, d4ohha2, d4ohha3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ohhA (A:)
    mtsrrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntg
    dyydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgk
    eaeklltekgkhgsflvresqshpgdfvlsvrtgddkgesndgkskvthvmircqelkyd
    vgggerfdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsklaett
    dkvkqgfweefetlqqqeckllysrkegqrqenknknryknilpfdhtrvvlhdgdpnep
    vsdyinaniimpefetkcnnskpkksyiatqgclqntvndfwrmvfqensrvivmttkev
    ergkskcvkywpdeyalkeygvmrvrnvkesaahdytlrelklskvgqgntertvwqyhf
    rtwpdhgvpsdpggvldfleevhhkqesimdagpvvvhcsagigrtgtfividilidiir
    ekgvdcdidvpktiqmvrsqrsgmvpteaqyrfiymavqhyietlqrrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ohhA (A:)
    srrwfhpnitgveaenllltrgvdgsflarpsksnpgdftlsvrrngavthikiqntgdy
    ydlyggekfatlaelvqyymehhgqlkekngdvielkyplncadptserwfhghlsgkea
    eklltekgkhgsflvresqshpgdfvlsvrtgddndgkskvthvmircqelkydvggger
    fdsltdlvehykknpmvetlgtvlqlkqplnttrinaaeiesrvrelsgfweefetlqqq
    eckllysrkegqrqenknknryknilpfdhtrvvlhdsdyinaniimpekksyiatqgcl
    qntvndfwrmvfqensrvivmttkevergkskcvkywpdeyalkeygvmrvrnvkesaah
    dytlrelklskvgqgntertvwqyhfrtwpdhgvpsdpggvldfleevhhkqesimdagp
    vvvhcsagigrtgtfividilidiirekgvdcdidvpktiqmvrsqrsgmvpteaqyrfi
    ymavqhyietlqrr