PDB entry 4oh9

View 4oh9 on RCSB PDB site
Description: Crystal Structure of the human MST2 SARAH homodimer
Deposited on 2014-01-17, released 2014-07-23
The last revision was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.238
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: STK3, KRS1, MST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13188 (2-50)
      • expression tag (0-1)
  • Chain 'B':
    Compound: Serine/threonine-protein kinase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: STK3, KRS1, MST2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13188 (2-50)
      • expression tag (1)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4oh9A (A:)
    gsdfdflknlsleelqmrlkaldpmmereieelrqrytakrqpildamdak
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4oh9B (B:)
    gsdfdflknlsleelqmrlkaldpmmereieelrqrytakrqpildamdak
    

    Sequence, based on observed residues (ATOM records):
    >4oh9B (B:)
    sdfdflknlsleelqmrlkaldpmmereieelrqrytakrqpildamdak