PDB entry 4oh9
View 4oh9 on RCSB PDB site
Description: Crystal Structure of the human MST2 SARAH homodimer
Deposited on
2014-01-17, released
2014-07-23
The last revision was dated
2014-07-23, with a file datestamp of
2014-07-18.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.238
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Serine/threonine-protein kinase 3
Species: Homo sapiens [TaxId:9606]
Gene: STK3, KRS1, MST2
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Serine/threonine-protein kinase 3
Species: Homo sapiens [TaxId:9606]
Gene: STK3, KRS1, MST2
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.
- Chain 'A':
Sequence; same for both SEQRES and ATOM records:
>4oh9A (A:)
gsdfdflknlsleelqmrlkaldpmmereieelrqrytakrqpildamdak
- Chain 'B':
Sequence, based on SEQRES records:
>4oh9B (B:)
gsdfdflknlsleelqmrlkaldpmmereieelrqrytakrqpildamdak
Sequence, based on observed residues (ATOM records):
>4oh9B (B:)
sdfdflknlsleelqmrlkaldpmmereieelrqrytakrqpildamdak