PDB entry 4ogx

View 4ogx on RCSB PDB site
Description: Crystal structure of Fab DX-2930 in complex with human plasma kallikrein at 2.4 Angstrom resolution
Class: hydrolase/antibody
Keywords: FAB, ANTIBODY, KALLIKREIN, BLOOD, PLASMA, PLASMA KALLIKREIN- MEDIATED EDEMA, ACUTE HEREDITARY ANGIOEDEMA, HAE, HMWK, serpin C1-inhibitor, C1-INH, hereditary angioedema, HAW, bradykinin, Fletcher factor, Kininogenin, serine protease, edema, HYDROLASE-ANTIBODY complex
Deposited on 2014-01-16, released 2014-07-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.188
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasma kallikrein
    Species: Homo sapiens [TaxId:9606]
    Gene: KLK3, KLKB1, KLKB1_HUMAN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03952 (0-End)
      • engineered mutation (5)
      • engineered mutation (62)
      • engineered mutation (103)
      • engineered mutation (112)
    Domains in SCOPe 2.04: d4ogxa_
  • Chain 'H':
    Compound: dx-2930 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OGX (0-End)
  • Chain 'L':
    Compound: dx-2930 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4OGX (0-End)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ogxA (A:)
    ivggtesswgewpwqvslqvkltaqrhlcggslighqwvltaahcfdglplqdvwriysg
    ilelsditkdtpfsqikeiiihqnykvsegnhdialiklqapleytefqkpislpskgdt
    stiytncwvtgwgfskekgeiqnilqkvniplvtneecqkryqdykitqrmvcagykegg
    kdackgdsggplvckhngmwrlvgitswgegcarreqpgvytkvaeymdwilektqssdg
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogxA (A:)
    ivggtesswgewpwqvslqvkltaqrhlcggslighqwvltaahcfdglplqdvwriysg
    ilelsditkdtpfsqikeiiihqnykvsegnhdialiklqapleytefqkpislpskgdt
    stiytncwvtgwgfskekgeiqnilqkvniplvtneecqkryqdykitqrmvcagykegg
    kdackgdsggplvckhngmwrlvgitswgegcarreqpgvytkvaeymdwilektq
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    No sequence available.