PDB entry 4ogv

View 4ogv on RCSB PDB site
Description: Co-Crystal Structure of MDM2 with Inhibitor Compound 49
Class: ligase/ligase inhibitor
Keywords: P53, protein-protein interaction, ligase-ligase inhibitor complex
Deposited on 2014-01-16, released 2014-04-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.257
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ogva_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ogvb_
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ogvc_
  • Heterogens: 2U7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ogvA (A:)
    sqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogvA (A:)
    qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydhivycsndl
    lgdlfgvpsfsvkehrkiytmiyrnlvvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ogvB (B:)
    sqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogvB (B:)
    qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydhivycsndl
    lgdlfgvpsfsvkehrkiytmiyrnlvvv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ogvC (C:)
    sqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivy
    csndllgdlfgvpsfsvkehrkiytmiyrnlvvvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogvC (C:)
    qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydhivycsndl
    lgdlfgvpsfsvkehrkiytmiyrnlvvv