PDB entry 4ogr

View 4ogr on RCSB PDB site
Description: crystal structure of P-TEFb complex with AFF4 and Tat
Class: transferase/viral protein
Keywords: P-TEFb, cyclin-dependent kinase 9, cyclin fold, intrinsically unstructured AFF4, transcriptional regulation at HIV promoter, binds TAR, N-terminal acetylation of Tat, transferase-viral protein complex
Deposited on 2014-01-16, released 2014-05-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.206
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclin-dependent kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK9, CDC2L4, TAK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ogra_
  • Chain 'B':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ogrb1, d4ogrb2
  • Chain 'C':
    Compound: AF4/FMR2 family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: AFF4, AF5Q31, MCEF, HSPC092
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: protein tat
    Species: Human immunodeficiency virus type 1 (HXB3 ISOLATE) [TaxId:11707]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Cyclin-dependent kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK9, CDC2L4, TAK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ogre_
  • Chain 'F':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ogrf1, d4ogrf2
  • Chain 'G':
    Compound: AF4/FMR2 family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: AFF4, AF5Q31, MCEF, HSPC092
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: protein tat
    Species: Human immunodeficiency virus type 1 (HXB3 ISOLATE) [TaxId:11707]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Cyclin-dependent kinase 9
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK9, CDC2L4, TAK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ogri_
  • Chain 'K':
    Compound: Cyclin-T1
    Species: Homo sapiens [TaxId:9606]
    Gene: CCNT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ogrk1, d4ogrk2
  • Chain 'L':
    Compound: AF4/FMR2 family member 4
    Species: Homo sapiens [TaxId:9606]
    Gene: AFF4, AF5Q31, MCEF, HSPC092
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: protein tat
    Species: Human immunodeficiency virus type 1 (HXB3 ISOLATE) [TaxId:11707]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ogrA (A:)
    ghmakqydsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekeg
    fpitalreikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvl
    vkftlseikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslak
    nsqpnrytnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhql
    alisqlcgsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvl
    dpaqridsddalnhdffwsdpmpsdlkgmlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogrA (A:)
    vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
    kilqllkhenvvnlieicrtkgsiylvfdfcehdlagllsnvlvkftlseikrvmqmlln
    glyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvtlwyr
    ppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpn
    vdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdff
    wsdpmpsdlkgmlst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ogrB (B:)
    megerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltin
    taivymhrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpd
    trseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatn
    slhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthe
    flqilektpnrlkriwnwraceaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogrB (B:)
    nnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivym
    hrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseay
    lqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhltt
    fslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldeltheflqile
    ktpnrlkriwnwrac
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ogrE (E:)
    ghmakqydsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekeg
    fpitalreikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvl
    vkftlseikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslak
    nsqpnrytnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhql
    alisqlcgsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvl
    dpaqridsddalnhdffwsdpmpsdlkgmlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogrE (E:)
    vecpfcdevskyeklakiggevfkarhrktgqkvalkkvlmenekegfpitalreikilq
    llkhenvvnlieicrtkgsiylvfdfcehdlagllsnvlvkftlseikrvmqmllnglyy
    ihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvtlwyrppel
    llgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvdny
    elyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffwsdp
    mpsdlkgmlst
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ogrF (F:)
    megerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltin
    taivymhrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpd
    trseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatn
    slhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthe
    flqilektpnrlkriwnwraceaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogrF (F:)
    nnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivym
    hrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseay
    lqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhltt
    fslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldeltheflqile
    ktpnrlkriwnwrac
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4ogrI (I:)
    ghmakqydsvecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekeg
    fpitalreikilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvl
    vkftlseikrvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslak
    nsqpnrytnrvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhql
    alisqlcgsitpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvl
    dpaqridsddalnhdffwsdpmpsdlkgmlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogrI (I:)
    vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
    kilqllkhenvvnlieicrtkaspkgsiylvfdfcehdlagllsnvlvkftlseikrvmq
    mllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvt
    lwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpe
    vwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddaln
    hdffwsdpmpsdlkgmlst
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4ogrK (K:)
    megerknnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltin
    taivymhrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpd
    trseaylqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatn
    slhlttfslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldelthe
    flqilektpnrlkriwnwraceaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ogrK (K:)
    nnnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivym
    hrfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseay
    lqqvqdlvilesiilqtlgfeltidhphthvvkctqlvraskdlaqtsyfmatnslhltt
    fslqytppvvacvcihlackwsnweipvstdgkhwweyvdatvtlelldeltheflqile
    ktpnrlkriwnwrac
    

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.