PDB entry 4ogn

View 4ogn on RCSB PDB site
Description: Co-Crystal Structure of MDM2 with Inhbitor Compound 3
Class: ligase/ligase inhibitor
Keywords: p53, protein-protein interaction, ligase-ligase inhibitor complex
Deposited on 2014-01-16, released 2014-04-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.195
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4ogna_
  • Heterogens: 2U5, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4ognA (A:)
msvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkr
lydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvv

    Sequence, based on observed residues (ATOM records): (download) 
    >4ognA (A:)
dgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydek
qqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvv