PDB entry 4ofn

View 4ofn on RCSB PDB site
Description: Monoclinic NaGST1
Class: transferase
Keywords: gst, transferase
Deposited on 2014-01-15, released 2014-12-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.294
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase-1
    Species: Necator americanus [TaxId:51031]
    Gene: gst-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ofna1, d4ofna2
  • Chain 'B':
    Compound: Glutathione S-transferase-1
    Species: Necator americanus [TaxId:51031]
    Gene: gst-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4ofnb1, d4ofnb2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ofnA (A:)
    mvhykltyfairgagecarqifaladqefedvrldkeqfakvkpdlpfgqvpvlevdgkq
    laqslaicrylarqfgfagkstfdeavvdsladqysdyrveiksffytvigmregdveql
    kkevllpardkffgfitkflkkspsgflvgdsltwvdllvsehnatmltfvpeflegype
    vkehmekiraipklkkwietrpetlf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ofnB (B:)
    mvhykltyfairgagecarqifaladqefedvrldkeqfakvkpdlpfgqvpvlevdgkq
    laqslaicrylarqfgfagkstfdeavvdsladqysdyrveiksffytvigmregdveql
    kkevllpardkffgfitkflkkspsgflvgdsltwvdllvsehnatmltfvpeflegype
    vkehmekiraipklkkwietrpetlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ofnB (B:)
    vhykltyfairgagecarqifaladqefedvrldkeqfakvkpdlpfgqvpvlevdgkql
    aqslaicrylarqfgfagkstfdeavvdsladqysdyrveiksffytvigmregdveqlk
    kevllpardkffgfitkflkkspsgflvgdsltwvdllvsehnatmltfvpeflegypev
    kehmekiraipklkkwietrpetlf