PDB entry 4ofe

View 4ofe on RCSB PDB site
Description: structural basis for thymine glycosylase activity on t:o6-methylg mismatch by methyl-cpg binding domain protein 4: implications for roles of arg468 in mismatch recognition and catalysis
Deposited on 2014-01-14, released 2015-04-22
The last revision was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyl-CpG-binding domain protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: MBD4, MED1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95243
      • engineered mutation (79)
      • engineered mutation (171)
  • Chain 'C':
    Compound: 12-mer DNA(T)
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: 12-mer DNA(G)
    Species: synthetic, synthetic
  • Heterogens: MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4ofeA (A:)
mgsshhhhhhssglvprgshmasmtggqqmgrgsefmalspprrkafkkwtpprspfnlv
qetlfhdpwklliatiflnktsgkmaipvlwkflekypsaevartadwrdvsellkplgl
ydlraktivkfsdeyltkqwkypielhgigkygndsyrifcvnewkqvhpenhklnkyhd
wlwenheklsls

    Sequence, based on observed residues (ATOM records):
    >4ofeA (A:)
wtpprspfnlvqetlfhdpwklliatiflnktsgkmaipvlwkflekypsaevartadwr
dvsellkplglydlraktivkfsdeyltkqwkypielhgigkygndsyrifcvnewkqvh
penhklnkyhdwlwenheklsl

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.