PDB entry 4oew

View 4oew on RCSB PDB site
Description: Crystal structure of the PDE5A1 catalytic domain in complex with novel inhibitors
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-01-14, released 2015-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5, PDE5A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oewa_
  • Heterogens: ZN, MG, 5IO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oewA (A:)
    mgsshhhhhhssglvprgshmeetrelqslaaavvpsaqtlkitdfsfsdfelsdletal
    ctirmftdlnlvqnfqmkhevlcrwilsvkknyrknvayhnwrhafntaqcmfaalkagk
    iqnkltdleilalliaalshdldhrgvnnsyiqrsehplaqlychsimehhhfdqclmil
    nspgnqilsglsieeykttlkiikqailatdlalyikrrgeffelirknqfnledphqke
    lflamlmtacdlsaitkpwpiqqriaelvateffdqgdrerkelnieptdlmnrekknki
    psmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oewA (A:)
    trelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhevlc
    rwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshdld
    hrgvnnsimehhhfdqclmilnspgnqilsglsieeykttlkiikqailatdlalyikrr
    geffelirknqfnledphqkelflamlmtacdlsaitkpwpiqqriaelvateffdqgkn
    kipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalaeqq