PDB entry 4oes

View 4oes on RCSB PDB site
Description: Crystal structure of NikA from Brucella suis in complex with Fe(III)-EDTA
Class: transport protein
Keywords: Extracytoplasmic, Nickel import, Metal transport, ABC-type importer, extracytoplasmic nickel-binding protein, TRANSPORT PROTEIN
Deposited on 2014-01-13, released 2014-10-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.195
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NikA protein
    Species: Brucella suis [TaxId:29461]
    Gene: NIKA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oesa_
  • Heterogens: EDT, FE, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oesA (A:)
    dpklnfswpvnvgplnphlyspnqmfaqnmvyeplvhynadgtvgpwlaesweasqdgrs
    ytfklredvkfsngevfdaaavkanidtvlqnrprhnwlelvnqmvsaevvgpykvrinl
    kkpyypllqelslprpfrfiapsqfknggtadgivapigtgpwkltetklgehdvftrnd
    sywgpkpayeqitvkvipdpntraiafeageidliygtegpispdtferfqkmgiyntel
    sepletrvlalntnhgatkdlavrkainhavdkdtmiatvlygtqkradtlfadnvpyan
    iglkpyafdpalaarlldeagwtakasgdirekdgqplaielcfigtdaisksmaeivqa
    dlrkvgidvkltgeeessiyarqrdgrfdmifnqtwgapydphafvssmrvpshadyqaq
    lglpdkakidaeigqvlvstdetarqalykdiltrlheeavylpltsvtamavakpevgk
    itfgamsseipfekltpkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oesA (A:)
    dpklnfswpvnvgplnphlyspnqmfaqnmvyeplvhynadgtvgpwlaesweasqdgrs
    ytfklredvkfsngevfdaaavkanidtvlqnrprhnwlelvnqmvsaevvgpykvrinl
    kkpyypllqelslprpfrfiapsqfknggtadgivapigtgpwkltetklgehdvftrnd
    sywgpkpayeqitvkvipdpntraiafeageidliygtegpispdtferfqkmgiyntel
    sepletrvlalntnhgatkdlavrkainhavdkdtmiatvlygtqkradtlfadnvpyan
    iglkpyafdpalaarlldeagwtakasgdirekdgqplaielcfigtdaisksmaeivqa
    dlrkvgidvkltgeeessiyarqrdgrfdmifnqtwgapydphafvssmrvpshadyqaq
    lglpdkakidaeigqvlvstdetarqalykdiltrlheeavylpltsvtamavakpevgk
    itfgamsseipfekltpk