PDB entry 4oen

View 4oen on RCSB PDB site
Description: Crystal structure of the second substrate binding domain of a putative amino acid ABC transporter from Streptococcus pneumoniae Canada MDR_19A
Class: transport protein
Keywords: center for structural genomics of infectious diseases (csgid), niaid, national institute of allergy and infectious diseases, alpha and beta protein, periplasmic binding protein type II fold, substrate binding domain of putative amino acid abc transporter system, transport protein
Deposited on 2014-01-13, released 2014-01-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.163
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Second substrate binding domain of putative amino acid ABC transporter
    Species: Streptococcus pneumoniae [TaxId:637987]
    Gene: SpneCM_010100001889
    Database cross-references and differences (RAF-indexed):
    • PDB 4OEN (Start-222)
  • Chain 'B':
    Compound: Second substrate binding domain of putative amino acid ABC transporter
    Species: Streptococcus pneumoniae [TaxId:637987]
    Gene: SpneCM_010100001889
    Database cross-references and differences (RAF-indexed):
    • PDB 4OEN (Start-222)
    Domains in SCOPe 2.03: d4oenb_
  • Heterogens: SO4, CL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4oenB (B:)
gkakyiiasdssfapfvfqnssnqytgidmelikaiakdqgfeieitnpgfdaaisavqa
gqadgiiagmsvtdarkatfdfsesyytantilgvkessniasyedlkgktvgvkngtas
qtfltenqskygykiktfadgssmydslntgaidavmddepvlkysisqgqklktpisgt
pigetafavkkganpeliemfnnglanlkangefqkildkyla

    Sequence, based on observed residues (ATOM records): (download) 
    >4oenB (B:)
kakyiiasdssfapfvfqnssnqytgidmelikaiakdqgfeieitnpgfdaaisavqag
qadgiiagmsvtdarkatfdfsesyytantilgvkessniasyedlkgktvgvkngtasq
tfltenqskygykiktfadgssmydslntgaidavmddepvlkysisqgqklktpisgtp
igetafavkkganpeliemfnnglanlkangefqkildkyla