PDB entry 4ods

View 4ods on RCSB PDB site
Description: Unliganded Fab structure of lipid A-specific antibody S55-3
Class: immune system
Keywords: Carbohydrate binding, IMMUNE SYSTEM
Deposited on 2014-01-10, released 2015-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: S55-3 Fab (IgG2b) heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4ODS (0-221)
  • Chain 'L':
    Compound: S55-3 Fab (IgG2b) heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4ODS (0-217)
    Domains in SCOPe 2.07: d4odsl1, d4odsl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4odsL (L:)
    divltqspaslavslgqratifcrasetvdsygnsfmhwyqqkpgqppklliyrasnles
    giparfsgsgsrtdftltinpveaddvatyycqqsnedprtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqnskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec