PDB entry 4odp

View 4odp on RCSB PDB site
Description: structure of slyd delta-if from thermus thermophilus in complex with s2-w23a peptide
Deposited on 2014-01-10, released 2015-01-14
The last revision was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase SlyD, Peptidyl-prolyl cis-trans isomerase FKBP1A chimera
    Species: Homo sapiens [TaxId:9606]
    Gene: TTHA0346, FKBP1, FKBP12, FKBP1A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SLE7 (0-End)
    • Uniprot P62942 (Start-76)
    • Uniprot Q5SLE7 (77-100)
      • expression tag (101-109)
  • Chain 'B':
    Compound: 30S ribosomal protein S2
    Species: Escherichia coli, synthetic [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, CA, NI, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4odpA (A:)
mkvgqdkvvtirytlqvegevldqgelsylhghrnlipgleealegreegeafqahvpae
kaygatghpgiipphatldfqvevvkvreatpeellhghahpsghhhhhh

    Sequence, based on observed residues (ATOM records):
    >4odpA (A:)
mkvgqdkvvtirytlqvegevldqgelsylhghrnlipgleealegreegeafqahvpae
kaipphatldfqvevvkvreatpeellhghahpsghhhhhh

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4odpB (B:)
tryanpkmkpfifga

    Sequence, based on observed residues (ATOM records):
    >4odpB (B:)
mkpfi