PDB entry 4odg

View 4odg on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant V23I/V66I/V74I/V99I at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, pdTp, cavity, pressure, HYDROLASE
Deposited on 2014-01-10, released 2014-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (22)
      • engineered mutation (65)
      • engineered mutation (73)
      • engineered mutation (98)
    Domains in SCOPe 2.08: d4odga_
  • Heterogens: THP, CA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4odgA (A:)
atstkklhkepatlikaidgdtiklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmienakkieiefdkgqrtdkygrglayiyadgkminealvrqglakvayvykpnnt
heqhlrkseaqakkeklniwsednadsgq

    Sequence, based on observed residues (ATOM records): (download) 
    >4odgA (A:)
lhkepatlikaidgdtiklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmi
enakkieiefdkgqrtdkygrglayiyadgkminealvrqglakvayvykpnntheqhlr
kseaqakkeklniws