PDB entry 4ode

View 4ode on RCSB PDB site
Description: Co-Crystal Structure of MDM2 with Inhibitor Compound 4
Class: ligase/ligase inhibitor
Keywords: p53, protein-protein interaction, ligase-ligase inhibitor complex
Deposited on 2014-01-10, released 2014-04-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4odea_
  • Heterogens: 2U0, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4odeA (A:)
msvptdgavttsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkr
lydekqqhivycsndllgdlfgvpsfsvkehrkiytmiyrnlvvv