PDB entry 4odc

View 4odc on RCSB PDB site
Description: Crystal structure of Trematomus bernacchii hemoglobin in a partially cyanided state
Class: oxygen transport/protein binding
Keywords: alpha protein, Globin fold, oxygen transport, OXYGEN TRANSPORT-PROTEIN BINDING complex
Deposited on 2014-01-10, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.165
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin subunit alpha
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4odca_
  • Chain 'B':
    Compound: Hemoglobin subunit beta
    Species: Trematomus bernacchii [TaxId:40690]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4odcb_
  • Heterogens: CYN, HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4odcA (A:)
    slsdkdkaavralwskigksadaigndalsrmivvypqtktyfshwpdvtpgsphikahg
    kkvmggialavskiddlktglmelseqhayklrvdpanfkilnhcilvvistmfpkeftp
    eahvsldkflsgvalalaeryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4odcB (B:)
    vewtdkersiisdifshmdyddigpkalsrclivypwtqrhfsgfgnlynaeaiignanv
    aahgikvlhgldrgvknmdniaatyadlstlhseklhvdpdnfkllsdcitivlaakmgh
    aftaetqgafqkflavvvsalgkqyh