PDB entry 4ocz

View 4ocz on RCSB PDB site
Description: Crystal structure of human soluble epoxide hydrolase complexed with 1-(1-isobutyrylpiperidin-4-yl)-3-(4-(trifluoromethyl)phenyl)urea
Class: hydrolase/hydrolase inhibitor
Keywords: domain-swapped dimer, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-01-09, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: 0.191
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional epoxide hydrolase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHX2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ocza1, d4ocza2
  • Heterogens: PO4, MG, 2RU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oczA (A:)
    mtlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitl
    sqwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgftta
    iltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsev
    vflddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshg
    yvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygess
    appeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslnt
    pfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmh
    kvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwacksl
    grkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilik
    wldsdarnppvvskm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oczA (A:)
    mtlraavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitl
    sqwiplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgftta
    iltntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsev
    vflddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpaplptscnpsdmshg
    yvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyrvlamdmkgygess
    appeieeycmevlckemvtfldklglsqavfighdwggmlvwymalfypervravaslnt
    pfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfkslfrasdesvlsmh
    kvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyrnmernwkwacksl
    grkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtqmdkptevnqilik
    wldsdarn