PDB entry 4ocr

View 4ocr on RCSB PDB site
Description: Crystal structure of human Fab CAP256-VRC26.01, a potent V1V2-directed HIV-1 neutralizing antibody
Class: immune system
Keywords: Fab, HIV-1, V1V2, CAP256, VRC26, IMMUNE SYSTEM
Deposited on 2014-01-09, released 2014-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.181
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CAP256-VRC26.01 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4OCR (0-End)
  • Chain 'L':
    Compound: CAP256-VRC26.01 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4OCR (Start-216)
    Domains in SCOPe 2.07: d4ocrl1, d4ocrl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4ocrL (L:)
    qsvltqppsvsaapgqkvtiscsgssstignnyvswyrllpgtapklliykndnrpsgip
    drfsgsksgtsatlgisglqtgdeadyycgtwdtslsgggvfgtgtkvtvlgqpkanptv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ocrL (L:)
    svltqppsvsaapgqkvtiscsgssstignnyvswyrllpgtapklliykndnrpsgipd
    rfsgsksgtsatlgisglqtgdeadyycgtwdtslsgggvfgtgtkvtvlgqpkanptvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs