PDB entry 4oc9

View 4oc9 on RCSB PDB site
Description: 2.35 Angstrom resolution crystal structure of putative O-acetylhomoserine (thiol)-lyase (metY) from Campylobacter jejuni subsp. jejuni NCTC 11168 with N'-Pyridoxyl-Lysine-5'-Monophosphate at position 205
Class: lyase
Keywords: O-acetylhomoserine (thiol)-lyase, PLP-dependent enzymes, Center for Structural Genomics of Infectious Diseases, CSGID, NIAID, National Institute of Allergy and Infectious Diseases, lyase
Deposited on 2014-01-08, released 2014-03-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9a_
  • Chain 'B':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9b_
  • Chain 'C':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9c_
  • Chain 'D':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9d_
  • Chain 'E':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9e_
  • Chain 'F':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9f_
  • Chain 'G':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9g_
  • Chain 'H':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9h_
  • Chain 'I':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9i_
  • Chain 'J':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9j_
  • Chain 'K':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9k_
  • Chain 'L':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9l_
  • Chain 'M':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9m_
  • Chain 'N':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9n_
  • Chain 'O':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9o_
  • Chain 'P':
    Compound: Putative O-acetylhomoserine (Thiol)-lyase
    Species: Campylobacter jejuni [TaxId:192222]
    Gene: Cj1727c, metB, metY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4oc9p_
  • Heterogens: IMD, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oc9A (A:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9A (A:)
    fnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnptsd
    vlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlknf
    giearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdnt
    vatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpdp
    syhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaekv
    anflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktqlf
    llaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkqaie
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oc9B (B:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9B (B:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliihpastthqlseeelqkagitkatirlsiglensddliadlkqaie
    s
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4oc9C (C:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9C (C:)
    fnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnptsd
    vlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlknf
    giearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdnt
    vatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpdp
    syhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaekv
    anflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktqlf
    llaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkqaie
    s
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4oc9D (D:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9D (D:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkqai
    es
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4oc9E (E:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9E (E:)
    fnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnptsd
    vlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlknf
    giearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdnt
    vatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpdp
    syhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaekv
    anflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktqlf
    llaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkqaie
    s
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4oc9F (F:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9F (F:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkqai
    es
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4oc9G (G:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9G (G:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkqai
    es
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4oc9H (H:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9H (H:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkqai
    es
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4oc9I (I:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9I (I:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliigitkatirlsiglensddliadlkqaie
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4oc9J (J:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9J (J:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliihpagitkatirlsiglensddliadlkqaies
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4oc9K (K:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9K (K:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliihpgitkatirlsiglensddliadlkqaies
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4oc9L (L:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9L (L:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliihpagitkatirlsiglensddliadlkqaies
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4oc9M (M:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9M (M:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliihpagitkatirlsiglensddliadlkqaies
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >4oc9N (N:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9N (N:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliihpitkatirlsiglensddliadlkqaies
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4oc9O (O:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9O (O:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliihpitkatirlsiglensddliadlkqaies
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4oc9P (P:)
    gmnfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnp
    tsdvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtl
    knfgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsic
    dntvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafnt
    pdpsyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqna
    ekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdkt
    qlfllaanlgdsksliihpastthsqlseeelqkagitkatirlsiglensddliadlkq
    aies
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oc9P (P:)
    nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnpts
    dvlgqrlanveggafgipvasgmaacfyalinlassgdnvaysnkiyggtqtlishtlkn
    fgiearefdiddldslekvidqntkaiffeslsnpqiaiadiekinqiakkhkivsicdn
    tvatpfllqpfkhgvdvivhslskyvsgqgtalggalierkdlndllknndrykafntpd
    psyhglnlntldlpifsirviitwlrdlgaslapqnawlllqgletlavriekhsqnaek
    vanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktql
    fllaanlgdsksliihpeelqkagitkatirlsiglensddliadlkqaies