PDB entry 4obt

View 4obt on RCSB PDB site
Description: Crystal structure of Arabidopsis thaliana cytosolic triose phosphate isomerase
Class: isomerase
Keywords: TIM Barrel, Glycolysis, Citosolyc, ISOMERASE
Deposited on 2014-01-07, released 2016-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triosephosphate isomerase, cytosolic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g55440, CTIMC, T22E16.100, TPI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4obta_
  • Chain 'B':
    Compound: Triosephosphate isomerase, cytosolic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g55440, CTIMC, T22E16.100, TPI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4obtb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4obtA (A:)
    gphmarkffvggnwkcngtaeevkkivntlneaqvpsqdvvevvvsppyvflplvkstlr
    sdffvaaqncwvkkggaftgevsaemlvnldipwvilghserrailnessefvgdkvaya
    laqglkviacvgetleereagstmdvvaaqtkaiadrvtnwsnvviayepvwaigtgkva
    spaqaqevhdelrkwlaknvsadvaattriiyggsvnggnckelggqadvdgflvggasl
    kpefidiikaaevkksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4obtA (A:)
    arkffvggnwkcngtaeevkkivntlneaqvpsqdvvevvvsppyvflplvkstlrsdff
    vaaqncwvkkggaftgevsaemlvnldipwvilghserrailnessefvgdkvayalaqg
    lkviacvgetleereagstmdvvaaqtkaiadrvtnwsnvviayepvwaigtgkvaspaq
    aqevhdelrkwlaknvsadvaattriiyggsvnggnckelggqadvdgflvggaslkpef
    idiikaaevk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4obtB (B:)
    gphmarkffvggnwkcngtaeevkkivntlneaqvpsqdvvevvvsppyvflplvkstlr
    sdffvaaqncwvkkggaftgevsaemlvnldipwvilghserrailnessefvgdkvaya
    laqglkviacvgetleereagstmdvvaaqtkaiadrvtnwsnvviayepvwaigtgkva
    spaqaqevhdelrkwlaknvsadvaattriiyggsvnggnckelggqadvdgflvggasl
    kpefidiikaaevkksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4obtB (B:)
    arkffvggnwkcngtaeevkkivntlneaqvpsqdvvevvvsppyvflplvkstlrsdff
    vaaqncwvkkggaftgevsaemlvnldipwvilghserrailnessefvgdkvayalaqg
    lkviacvgetleereagstmdvvaaqtkaiadrvtnwsnvviayepvwaigtgkvaspaq
    aqevhdelrkwlaknvsadvaattriiyggsvnggnckelggqadvdgflvggaslkpef
    idiikaaevk