PDB entry 4obk

View 4obk on RCSB PDB site
Description: crystal structure of inactive hiv-1 protease in complex with the p1-p6 substrate variant (l449f/s451n)
Deposited on 2014-01-07, released 2014-11-26
The last revision was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1 [TaxId:11685]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered mutation (6)
    • engineered mutation (24)
    • engineered mutation (63)
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus type 1 [TaxId:11685]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03369 (0-98)
    • engineered mutation (6)
    • engineered mutation (24)
    • engineered mutation (63)
• Chain 'C':
  Compound: p1-p6 peptide
  Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03349 (0-9)
    • engineered mutation (5)
    • engineered mutation (7)
• Heterogens: GOL, EDO, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >4obkA (A:)
  pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >4obkB (B:)
  pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
  qipieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >4obkC (C:)
  rpgnffqnrp