PDB entry 4obi

View 4obi on RCSB PDB site
Description: crystal structure of a duf1312 family protein (ef3258) from enterococcus faecalis v583 at 1.73 a resolution
Deposited on 2014-01-07, released 2014-02-12
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: EF_3258, I574_00339, NP_816855.1, OO5_00326
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PG4, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4obiA (A:)
gmqnrgqeaatyqavlkvdnkvikvfdlkkdgphytykyeakdgdynlievdgdrirvke
ancadlvdvrrgwiskpgetpiaclphnlfitveasdgsedgsliy

    Sequence, based on observed residues (ATOM records):
    >4obiA (A:)
tyqavlkvdnkvikvfdlkkdgphytykyeakdgdynlievdgdrirvkeancadlvdvr
rgwiskpgetpiaclphnlfitveasd