PDB entry 4ob0

View 4ob0 on RCSB PDB site
Description: Crystal Structure of Nitrile Hydratase from Pseudonocardia thermophila bound to Phenyl Boronic Acid
Class: Lyase
Keywords: Nitrile Hydratase, nucleophile, Lyase
Deposited on 2014-01-06, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.154
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cobalt-containing nitrile hydratase subunit alpha
    Species: Pseudonocardia thermophila [TaxId:1848]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ob0a_
  • Chain 'B':
    Compound: Cobalt-containing nitrile hydratase subunit beta
    Species: Pseudonocardia thermophila [TaxId:1848]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ob0b_
  • Heterogens: CO, PBC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ob0A (A:)
    mtenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvv
    kawtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcscypwpvlg
    lppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdg
    wseeelatlvtresmigvepakavhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ob0A (A:)
    tenilrksdeeiqkeitarvkalesmlieqgilttsmidrmaeiyenevgphlgakvvvk
    awtdpefkkrlladgteackelgigglqgedmmwventdevhhvvvctlcscypwpvlgl
    ppnwfkepqyrsrvvreprqllkeefgfevppskeikvwdsssemrfvvlpqrpagtdgw
    seeelatlvtresmigvepakav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ob0B (B:)
    mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
    aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
    qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
    tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdtkaaaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ob0B (B:)
    mngvydvggtdglgpinrpadepvfraewekvafamfpatfragfmgldefrfgieqmnp
    aeylespyywhwirtyihhgvrtgkidleelerrtqyyrenpdaplpeheqkpeliefvn
    qavygglpasrevdrppkfkegdvvrfstaspkgharraryvrgktgtvvkhhgayiypd
    tagnglgecpehlytvrftaqelwgpegdpnssvyydcwepyielvdt