PDB entry 4oaq

View 4oaq on RCSB PDB site
Description: Crystal structure of the R-specific Carbonyl Reductase from Candida parapsilosis ATCC 7330
Deposited on 2014-01-06, released 2015-02-11
The last revision was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.204
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: R-specific carbonyl reductase
    Species: Candida parapsilosis [TaxId:5480]
    Gene: CpCR
    Database cross-references and differences (RAF-indexed):
    • Uniprot M4VRJ6 (Start-365)
      • expression tag (366)
  • Chain 'B':
    Compound: R-specific carbonyl reductase
    Species: Candida parapsilosis [TaxId:5480]
    Gene: CpCR
    Database cross-references and differences (RAF-indexed):
    • Uniprot M4VRJ6 (Start-365)
      • expression tag (366)
  • Heterogens: NDP, DTT, ZN, EPE, GOL, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4oaqA (A:)
    mtkavpdkfqgfavsdpknwnrpklasyerkqinphdvvlknevcglcysdihtlsagwq
    plqrdnlvvgheiigeviavgdevtefkvgdrvgigaassscrscqrcdsdneqyckqga
    atynskdvrsnnyvtqggysshsiadekfvfaipedlpssygaplmcagitvfsplirnl
    gldargknvgiigigglghlalqfanamganvtafsrssskkeqamklgahdfvatgedk
    twyknyddhfdfilncasgidglnlseylstlkvdkkfvsvglppsedkfevspftflqq
    gasfgssllgsktevkemlnlaakhnvrpmieevpiseencakaldrchagdvryrfvft
    dfdkafa
    

    Sequence, based on observed residues (ATOM records):
    >4oaqA (A:)
    kavpdkfqgfavsdpknwnrpklasyerkqinphdvvlknevcglcysdihtlsagwqpl
    qrdnlvvgheiigeviavgdevtefkvgdrvgigaassscrscqrcdsdneqyckqgaat
    ynskdvrsnnyvtqggysshsiadekfvfaipedlpssygaplmcagitvfsplirnlgl
    dargknvgiigigglghlalqfanamganvtafsrssskkeqamklgahdfvatgedktw
    yknyddhfdfilncasgidglnlseylstlkvdkkfvsvglppsedkfevspftflqqga
    sfgssllgsktevkemlnlaakhnvrpmieevpiseencakaldrchagdvryrfvftdf
    dkafa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4oaqB (B:)
    mtkavpdkfqgfavsdpknwnrpklasyerkqinphdvvlknevcglcysdihtlsagwq
    plqrdnlvvgheiigeviavgdevtefkvgdrvgigaassscrscqrcdsdneqyckqga
    atynskdvrsnnyvtqggysshsiadekfvfaipedlpssygaplmcagitvfsplirnl
    gldargknvgiigigglghlalqfanamganvtafsrssskkeqamklgahdfvatgedk
    twyknyddhfdfilncasgidglnlseylstlkvdkkfvsvglppsedkfevspftflqq
    gasfgssllgsktevkemlnlaakhnvrpmieevpiseencakaldrchagdvryrfvft
    dfdkafa
    

    Sequence, based on observed residues (ATOM records):
    >4oaqB (B:)
    kavpdkfqgfavsdpknwnrpklasyerkqinphdvvlknevcglcysdihtlsagwqpl
    qrdnlvvgheiigeviavgdevtefkvgdrvgigaassscrscqrcdsdneqyckqgaat
    ynskdvrsnnyvtqggysshsiadekfvfaipedlpssygaplmcagitvfsplirnlgl
    dargknvgiigigglghlalqfanamganvtafsrssskkeqamklgahdfvatgedktw
    yknyddhfdfilncasgidglnlseylstlkvdkkfvsvglppsedkfevspftflqqga
    sfgssllgsktevkemlnlaakhnvrpmieevpiseencakaldrchagdvryrfvftdf
    dkafa