PDB entry 4oal

View 4oal on RCSB PDB site
Description: Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (ZmCKO4) in complex with phenylurea inhibitor CPPU in alternative spacegroup
Class: oxidoreductase
Keywords: flavoprotein, cytokinin oxidase/dehydrogenase, phenyl-urea inhibitor, oxidoreductase
Deposited on 2014-01-05, released 2015-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytokinin dehydrogenase 4
    Species: Zea mays [TaxId:4577]
    Gene: CKX4, CKX4 (CKO4)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4oala1, d4oala2
  • Chain 'B':
    Compound: Cytokinin dehydrogenase 4
    Species: Zea mays [TaxId:4577]
    Gene: CKX4, CKX4 (CKO4)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4oalb1, d4oalb2
  • Heterogens: FAD, 245, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4oalA (A:)
    aghmlpveppaellqlgggdvgggrlsvdasdiaeasrdfggvaraepmavfhpraagdv
    aglvgaafrsargfrvsarghghsisgqaqaaggvvvdmsrgrgpgaavaralpvhsaal
    gghyvdvwggelwvdvlnwtlshgglaprswtdylylsvggtlsnagisgqafhhgpqis
    nvyeldvvtgkgevvtcsetenpdlffgvlgglgqfgiitrarialerapkrvrwiraly
    snfseftadqerlislgsgggrrfdyvegfvvaaeglinnwrssffspqnpvkltslkhh
    ssvlyclevtknyddetagsvdqdvdtllgelnflpgtvfttdlpyvdfldrvhkaelkl
    rakgmwevphpwlnlfvpasriadfdrgvfrgvlggrtagaggpvliypmnkhkwdprss
    avtpdeevfylvaflrsalpgapeslealarqnqrildfcagtgigakqylpghkarhew
    aehfgaarwdrfarlkaefdprailaagqgifrppgspalaads
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oalA (A:)
    ggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarghg
    hsisgqaqaaggvvvdmsaralpvhsaalgghyvdvwggelwvdvlnwtlshgglaprsw
    tdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcsetenpdlffgvlg
    glgqfgiitrarialerapkrvrwiralysnfseftadqerlislgrrfdyvegfvvaav
    lyclevtknyddetagsvdqdvdtllgelnflpgtvfttdlpyvdfldrvhkaelklrak
    gmwevphpwlnlfvpasriadfdrgvfrgvlggpvliypmnkhkwdprssavtpdeevfy
    lvaflrsalpgapeslealarqnqrildfcagtgigakqylpghkarhewaehfgaarwd
    rfarlkaefdprailaagqgifrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4oalB (B:)
    aghmlpveppaellqlgggdvgggrlsvdasdiaeasrdfggvaraepmavfhpraagdv
    aglvgaafrsargfrvsarghghsisgqaqaaggvvvdmsrgrgpgaavaralpvhsaal
    gghyvdvwggelwvdvlnwtlshgglaprswtdylylsvggtlsnagisgqafhhgpqis
    nvyeldvvtgkgevvtcsetenpdlffgvlgglgqfgiitrarialerapkrvrwiraly
    snfseftadqerlislgsgggrrfdyvegfvvaaeglinnwrssffspqnpvkltslkhh
    ssvlyclevtknyddetagsvdqdvdtllgelnflpgtvfttdlpyvdfldrvhkaelkl
    rakgmwevphpwlnlfvpasriadfdrgvfrgvlggrtagaggpvliypmnkhkwdprss
    avtpdeevfylvaflrsalpgapeslealarqnqrildfcagtgigakqylpghkarhew
    aehfgaarwdrfarlkaefdprailaagqgifrppgspalaads
    

    Sequence, based on observed residues (ATOM records): (download)
    >4oalB (B:)
    ggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarghg
    hsisgqaqaaggvvvdmsaralpvhsaalgghyvdvwggelwvdvlnwtlshgglaprsw
    tdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcsetenpdlffgvlg
    glgqfgiitrarialerapkrvrwiralysnfseftadqerlislgrrfdyvegfvvaav
    lyclevtknyddetagsvdqdvdtllgelnflpgtvfttdlpyvdfldrvhkaelklrak
    gmwevphpwlnlfvpasriadfdrgvfrgvlggpvliypmnkhkwdprssavtpdeevfy
    lvaflrsalpgapeslealarqnqrildfcagtgigakqylpghkarhewaehfgaarwd
    rfarlkaefdprailaagqgifrp