PDB entry 4o9e

View 4o9e on RCSB PDB site
Description: Crystal structure of QdtA, a sugar 3,4-ketoisemerase from Thermoanaerobacterium thermosaccharolyticum in complex with TDP
Class: isomerase
Keywords: cupin, 3,4-ketoisomerase, TDP-sugar binding, ISOMERASE
Deposited on 2014-01-02, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: QdtA
    Species: Thermoanaerobacterium thermosaccharolyticum [TaxId:1517]
    Gene: qdtA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6TFC5 (0-135)
      • see remark 999 (51)
      • see remark 999 (93-94)
      • see remark 999 (115)
      • expression tag (136)
    Domains in SCOPe 2.07: d4o9ea1, d4o9ea2
  • Chain 'B':
    Compound: QdtA
    Species: Thermoanaerobacterium thermosaccharolyticum [TaxId:1517]
    Gene: qdtA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6TFC5 (0-135)
      • see remark 999 (51)
      • see remark 999 (93-94)
      • see remark 999 (115)
      • expression tag (136)
    Domains in SCOPe 2.07: d4o9eb1, d4o9eb2
  • Heterogens: TYD, TDR, 4TD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o9eA (A:)
    mlynvalikfkdiadkyghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvl
    iclngsvkirlkipdeekiielndpsvglyigplvwremfdftegcvllvlaseyydetd
    yirnydfyideakkrflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o9eA (A:)
    mlynvalikfkdiadkyghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvl
    iclngsvkirlkipdeekiielndpsvglyigplvwremfdftegcvllvlaseyydetd
    yirnydfyideakkrfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o9eB (B:)
    mlynvalikfkdiadkyghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvl
    iclngsvkirlkipdeekiielndpsvglyigplvwremfdftegcvllvlaseyydetd
    yirnydfyideakkrflehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o9eB (B:)
    mlynvalikfkdiadkyghltpiegkidipfdikrvyyitkvdkditrgyhshkklhqvl
    iclngsvkirlkipdeekiielndpsvglyigplvwremfdftegcvllvlaseyydetd
    yirnydfyideakkrfl