PDB entry 4o98

View 4o98 on RCSB PDB site
Description: Crystal structure of Pseudomonas oleovorans PoOPH mutant H250I/I263W
Class: hydrolase
Keywords: alphabeta/betaalpha sandwich, organophophorus hydrolase, beta-lactamase superfamily, Hydrolase, Zinc binding
Deposited on 2014-01-02, released 2014-12-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-03, with a file datestamp of 2014-11-28.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.18
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Organophosphorus hydrolase
    Species: Pseudomonas oleovorans [TaxId:301]
    Gene: OPHC
    Database cross-references and differences (RAF-indexed):
    • PDB 4O98
    Domains in SCOPe 2.05: d4o98a_
  • Chain 'B':
    Compound: Organophosphorus hydrolase
    Species: Pseudomonas oleovorans [TaxId:301]
    Gene: OPHC
    Database cross-references and differences (RAF-indexed):
    • PDB 4O98
    Domains in SCOPe 2.05: d4o98b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o98A (A:)
    mrlfslstalssamialvslplqaaapaqqktqvpgyyrmalgdfevtalydgyvdlpas
    llkgiddkdlqsllarmfvasekgvqtavnaylintgdnlvlidtgaaqcfgptlgvvqt
    nlkasgyqpeqvdtvllthlhpdhacglvnadgspaypnatvevpqaeaefwldeatmak
    apegmqgmfkmarqavapyakmnklkpyktegellpgvslvassghtpghtsylfksggq
    sllvwgdilinhavqfakpevvwefdvdsdqarqsrqrilaeaatdklwvagahlpfpgl
    ghvreeaqgyawvpvefspirsdrklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o98A (A:)
    apaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekgv
    qtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdha
    cglvnadgspaypnatvevpqaeaefwldeatmakapegmqgmfkmarqavapyakmnkl
    kpyktegellpgvslvassghtpghtsylfksggqsllvwgdilinhavqfakpevvwef
    dvdsdqarqsrqrilaeaatdklwvagahlpfpglghvreeaqgyawvpvefspirsdrk
    laaale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o98B (B:)
    mrlfslstalssamialvslplqaaapaqqktqvpgyyrmalgdfevtalydgyvdlpas
    llkgiddkdlqsllarmfvasekgvqtavnaylintgdnlvlidtgaaqcfgptlgvvqt
    nlkasgyqpeqvdtvllthlhpdhacglvnadgspaypnatvevpqaeaefwldeatmak
    apegmqgmfkmarqavapyakmnklkpyktegellpgvslvassghtpghtsylfksggq
    sllvwgdilinhavqfakpevvwefdvdsdqarqsrqrilaeaatdklwvagahlpfpgl
    ghvreeaqgyawvpvefspirsdrklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o98B (B:)
    apaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekgv
    qtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdha
    cglvnadgspaypnatvevpqaeaefwldeatmakapegmqgmfkmarqavapyakmnkl
    kpyktegellpgvslvassghtpghtsylfksggqsllvwgdilinhavqfakpevvwef
    dvdsdqarqsrqrilaeaatdklwvagahlpfpglghvreeaqgyawvpvefspirsdrk
    laaaleh