PDB entry 4o95

View 4o95 on RCSB PDB site
Description: Crystal structure of maize cytokinin oxidase/dehydrogenase 4 (ZmCKO4) in complex with phenylurea inhibitor CPPU
Class: oxidoreductase
Keywords: cytokinin, flavoprotein, phenyl-urea inhibitor, oxidoreductase
Deposited on 2014-01-01, released 2015-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-25, with a file datestamp of 2015-11-20.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytokinin dehydrogenase 4
    Species: Zea mays [TaxId:4577]
    Gene: CKX4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4o95a1, d4o95a2
  • Heterogens: FAD, 245, EDO, DMS, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o95A (A:)
    aghmlpveppaellqlgggdvgggrlsvdasdiaeasrdfggvaraepmavfhpraagdv
    aglvgaafrsargfrvsarghghsisgqaqaaggvvvdmsrgrgpgaavaralpvhsaal
    gghyvdvwggelwvdvlnwtlshgglaprswtdylylsvggtlsnagisgqafhhgpqis
    nvyeldvvtgkgevvtcsetenpdlffgvlgglgqfgiitrarialerapkrvrwiraly
    snfseftadqerlislgsgggrrfdyvegfvvaaeglinnwrssffspqnpvkltslkhh
    ssvlyclevtknyddetagsvdqdvdtllgelnflpgtvfttdlpyvdfldrvhkaelkl
    rakgmwevphpwlnlfvpasriadfdrgvfrgvlggrtagaggpvliypmnkhkwdprss
    avtpdeevfylvaflrsalpgapeslealarqnqrildfcagtgigakqylpghkarhew
    aehfgaarwdrfarlkaefdprailaagqgifrppgspalaads
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o95A (A:)
    vgggrlsvdasdiaeasrdfggvaraepmavfhpraagdvaglvgaafrsargfrvsarg
    hghsisgqaqaaggvvvdmsrgrgpgaavaralpvhsaalgghyvdvwggelwvdvlnwt
    lshgglaprswtdylylsvggtlsnagisgqafhhgpqisnvyeldvvtgkgevvtcset
    enpdlffgvlgglgqfgiitrarialerapkrvrwiralysnfseftadqerlislgsgg
    grrfdyvegfvvaasvlyclevtknyddetagsvdqdvdtllgelnflpgtvfttdlpyv
    dfldrvhkaelklrakgmwevphpwlnlfvpasriadfdrgvfrgvlggrtagaggpvli
    ypmnkhkwdprssavtpdeevfylvaflrsalpgapeslealarqnqrildfcagtgiga
    kqylpghkarhewaehfgaarwdrfarlkaefdprailaagqgifrp