PDB entry 4o8r

View 4o8r on RCSB PDB site
Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with 5,6-dihydrouridine 5'-monophosphate
Class: lyase
Keywords: tim barrel, OROTIDINE 5'-MONOPHOSPHATE DECARBOXYLASE, 5,6-DIHYDROURIDINE 5'-MONOPHOSPHATE, LYASE
Deposited on 2013-12-29, released 2014-01-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-01-22, with a file datestamp of 2014-01-17.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.204
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8ra_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8rb_
  • Chain 'C':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232 (0-End)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8rc_
  • Chain 'D':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8rd_
  • Chain 'E':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8re_
  • Chain 'F':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8rf_
  • Chain 'G':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8rg_
  • Chain 'H':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8rh_
  • Chain 'I':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8ri_
  • Chain 'J':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8rj_
  • Chain 'K':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8rk_
  • Chain 'L':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8rl_
  • Chain 'M':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: pyrF, MTH_129
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26232
      • engineered mutation (100)
    Domains in SCOPe 2.07: d4o8rm_
  • Heterogens: H2U, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o8rA (A:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rA (A:)
    rvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfg
    criiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfllt
    emshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvga
    qggdpgetlrfadaiivgrsiyladnpaaaaagiiesikd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o8rB (B:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rB (B:)
    dvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcr
    iiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltem
    shpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqg
    gdpgetlrfadaiivgrsiyladnpaaaaagiiesikdl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4o8rC (C:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rC (C:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4o8rD (D:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rD (D:)
    vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
    iadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltems
    hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqgg
    dpgetlrfadaiivgrsiyladnpaaaaagiiesik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4o8rE (E:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rE (E:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
    pgetlrfadaiivgrsiyladnpaaaaagiiesikdl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4o8rF (F:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rF (F:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
    pgetlrfadaiivgrsiyladnpaaaaagiiesik
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4o8rG (G:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rG (G:)
    mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
    adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
    pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
    pgetlrfadaiivgrsiyladnpaaaaagiies
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4o8rH (H:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rH (H:)
    vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
    iadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltems
    hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqgg
    dpgetlrfadaiivgrsiyladnpaaaaagiiesi
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4o8rI (I:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rI (I:)
    lilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriiadfkva
    dipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshpgaemf
    iqgaadeiarmgvdlgvknyvgprperlsrlreiigqdsflisppgetlrfadaiivgrs
    iyladnpaaaaagiies
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4o8rJ (J:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rJ (J:)
    vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
    iadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltems
    hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqgg
    dpgetlrfadaiivgrsiyladnpaaaaagiiesikdl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4o8rK (K:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rK (K:)
    dvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriia
    dfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshp
    gaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdp
    getlrfadaiivgrsiyladnpaaaaagiiesikdl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4o8rL (L:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rL (L:)
    dvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriia
    dfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshp
    gaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggdp
    getlrfadaiivgrsiyladnpaaaaagiiesi
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4o8rM (M:)
    mrsrrvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefr
    krfgcriiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrev
    flltemshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisp
    gvgaqggdpgetlrfadaiivgrsiyladnpaaaaagiiesikdllnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8rM (M:)
    vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
    iadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltems
    hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqgg
    dpgetlrfadaiivgrsiyladnpaaaaagiiesikdl