PDB entry 4o8f

View 4o8f on RCSB PDB site
Description: Crystal Structure of the complex between PPARgamma mutant R357A and rosiglitazone
Class: TRANSCRIPTION/TRANSCRIPTION inhibitor
Keywords: BUNDLE OF ALPHA-HELICES, SMALL FOUR-STRANDED BETA-SHEET, Transcription Factor, RXRalpha, TRANSCRIPTION-TRANSCRIPTION inhibitor complex
Deposited on 2013-12-27, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.24
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1C3, PPARG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (Start-286)
      • engineered mutation (166)
    Domains in SCOPe 2.07: d4o8fa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1C3, PPARG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (Start-286)
      • engineered mutation (166)
    Domains in SCOPe 2.07: d4o8fb_
  • Heterogens: BRL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o8fA (A:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslakpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8fA (A:)
    esadlralakhlydsyiksfpltkakarailtgktspfviydmnslmmgedtplevairi
    fqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvli
    segqgfmtreflkslakpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgll
    nvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktel
    hpllqeiykdly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o8fB (B:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslakpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8fB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkievai
    rifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgv
    lisegqgfmtreflkslakpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpg
    llnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvihpl
    lqeiykdly