PDB entry 4o8e

View 4o8e on RCSB PDB site
Description: Crystal structure of the complex of type I ribosome inactivating protein from Momordica balsamina with uridine triphosphate at 2.0 A resolution
Class: hydrolase
Keywords: Ligand binding, Hydrolase, uridine diphosphate, uridine triphosphate
Deposited on 2013-12-27, released 2014-01-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rRNA N-glycosidase
  Species: Momordica balsamina [TaxId:3672]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D9J2T9 (0-245)
  Domains in SCOPe 2.08: d4o8ea_
• Heterogens: GOL, NAG, UTP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4o8eA (A:)
  dvsfrlsgadpssygmfikdlrnalphtekvyniplllpsvsgagryllmhlfnydgnti
  tvavdvtnvyimgylalttsyffnepaadlasqyvfrsarrkitlpysgnyerlqiaagk
  prekipiglpaldtaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
  pssatislenswsglskqiqlaqgnngvfrtptvlvdskgnrvqitnvtsnvvtsniqll
  lntkni