PDB entry 4o8c

View 4o8c on RCSB PDB site
Description: Structure of the H170Y mutant of thermostable p-nitrophenylphosphatase from Bacillus Stearothermophilus
Class: hydrolase
Keywords: Phosphatase, HYDROLASE
Deposited on 2013-12-27, released 2014-06-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermostable NPPase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L1N9 (6-260)
      • engineered mutation (175)
    Domains in SCOPe 2.07: d4o8ca_
  • Chain 'B':
    Compound: Thermostable NPPase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L1N9 (6-260)
      • engineered mutation (175)
    Domains in SCOPe 2.07: d4o8cb_
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o8cA (A:)
    hhhhhhmrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstrtpeqva
    dklvsldipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenad
    vvivgldrevtyeklavaclavrngaklistngdlalptergfmpgngaftalisystqv
    katfvgkpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttvek
    lkeykqqptysmkslddwkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8cA (A:)
    mrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstrtpeqvadklvsl
    dipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenadvvivgl
    drevtyeklavaclavrngaklistngdlalptergfmpgngaftalisystqvkatfvg
    kpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttveklkeykq
    qptysmkslddwkfl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o8cB (B:)
    hhhhhhmrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstrtpeqva
    dklvsldipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenad
    vvivgldrevtyeklavaclavrngaklistngdlalptergfmpgngaftalisystqv
    katfvgkpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttvek
    lkeykqqptysmkslddwkfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o8cB (B:)
    mrkyngylidldgtmyrgteridaasgfikelnrlhipylfvtnnstrtpeqvadklvsl
    dipatpeqiftssmatanyvydldqnamiyfigeeglykalkekgfsfadenadvvivgl
    drevtyeklavaclavrngaklistngdlalptergfmpgngaftalisystqvkatfvg
    kpepiimeqalkvlgtnknetimvgdnydtdilagiragldtllvhtgvttveklkeykq
    qptysmkslddwkfl