PDB entry 4o6v

View 4o6v on RCSB PDB site
Description: Crystal Structure of a 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) from Brucella suis
Class: oxidoreductase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, dehydrogenase, OXIDOREDUCTASE
Deposited on 2013-12-23, released 2014-01-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.148
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oxidoreductase, short-chain dehydrogenase/reductase family
    Species: Brucella suis [TaxId:470137]
    Gene: BSUIS_A0748
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4o6va_
  • Chain 'B':
    Compound: Oxidoreductase, short-chain dehydrogenase/reductase family
    Species: Brucella suis [TaxId:470137]
    Gene: BSUIS_A0748
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4o6vb_
  • Chain 'C':
    Compound: Oxidoreductase, short-chain dehydrogenase/reductase family
    Species: Brucella suis [TaxId:470137]
    Gene: BSUIS_A0748
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0CL43 (8-241)
      • expression tag (7)
    Domains in SCOPe 2.05: d4o6vc_
  • Chain 'D':
    Compound: Oxidoreductase, short-chain dehydrogenase/reductase family
    Species: Brucella suis [TaxId:470137]
    Gene: BSUIS_A0748
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4o6vd_
  • Heterogens: GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o6vA (A:)
    mahhhhhhmtiqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigv
    tgsnqsnddlqklvdqtlekwgridvlvnsaghgprapileitdedwhkgmdtyflnavr
    parlvvpamqkqksgviinistawafepsamfptsavfraglasftkifadtyaaenirm
    nnvlpgwidslptteerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltr
    sv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o6vA (A:)
    iqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigvtgsnqsnddl
    qklvdqtlekwgridvlvnsagrapileitdedwhkgmdtyflnavrparlvvpamqkqk
    sgviinistawafepsamfptsavfraglasftkifadtyaaenirmnnvlpgwidslpt
    teerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltrsv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o6vB (B:)
    mahhhhhhmtiqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigv
    tgsnqsnddlqklvdqtlekwgridvlvnsaghgprapileitdedwhkgmdtyflnavr
    parlvvpamqkqksgviinistawafepsamfptsavfraglasftkifadtyaaenirm
    nnvlpgwidslptteerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltr
    sv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o6vB (B:)
    iqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigvtgsnqsnddl
    qklvdqtlekwgridvlvnsaghgprapileitdedwhkgmdtyflnavrparlvvpamq
    kqksgviinistawafepsamfptsavfraglasftkifadtyaaenirmnnvlpgwids
    lptteerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltrsv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4o6vC (C:)
    mahhhhhhmtiqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigv
    tgsnqsnddlqklvdqtlekwgridvlvnsaghgprapileitdedwhkgmdtyflnavr
    parlvvpamqkqksgviinistawafepsamfptsavfraglasftkifadtyaaenirm
    nnvlpgwidslptteerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltr
    sv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o6vC (C:)
    hmtiqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigvtgsnqsn
    ddlqklvdqtlekwgridvlvnsaghgprapileitdedwhkgmdtyflnavrparlvvp
    amqkqksgviinistawafepsamfptsavfraglasftkifadtyaaenirmnnvlpgw
    idslptteerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltrsv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4o6vD (D:)
    mahhhhhhmtiqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigv
    tgsnqsnddlqklvdqtlekwgridvlvnsaghgprapileitdedwhkgmdtyflnavr
    parlvvpamqkqksgviinistawafepsamfptsavfraglasftkifadtyaaenirm
    nnvlpgwidslptteerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltr
    sv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o6vD (D:)
    iqkvaiitaggsgmgaasarrlaqdgfavailsssgkgealakelggigvtgsnqsnddl
    qklvdqtlekwgridvlvnsaghgprapileitdedwhkgmdtyflnavrparlvvpamq
    kqksgviinistawafepsamfptsavfraglasftkifadtyaaenirmnnvlpgwids
    lptteerresvpmqrygkseeiaatvsflasdgaayitgqnlrvdggltrsv