PDB entry 4o6e

View 4o6e on RCSB PDB site
Description: Discovery of 5,6,7,8-tetrahydropyrido[3,4-d]pyrimidine Inhibitors of Erk2
Class: transferase/transferase inhibitor
Keywords: protein Kinase, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-12-20, released 2014-05-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.183
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK1, ERK2, PRKM1, PRKM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4o6ea_
  • Heterogens: 2SH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o6eA (A:)
    mgsshhhhhhssglvprgshmvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrva
    ikkispfehqtycqrtlreikillrfrheniigindiiraptieqmkdvyivqdlmetdl
    ykllktqhlsndhicyflyqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglar
    vadpdhdhtgflteyvatrwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkh
    yldqlnhilgilgspsqedlnciinlkarnyllslphknkvpwnrlfpnadskaldlldk
    mltfnphkrieveqalahpyleqyydpsdepiaeapfkfdmelddlpkeklkelifeeta
    rfqpgyrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o6eA (A:)
    mvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlrei
    killrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyflyq
    ilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpvatrwyrapeimlnyt
    ksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqedlnciinlkarnylls
    lphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalahpyleqyydpsdepiae
    apfkelddlpkeklkelifeetarfqpg