PDB entry 4o5n

View 4o5n on RCSB PDB site
Description: Crystal structure of A/Victoria/361/2011 (H3N2) influenza virus hemagglutinin
Class: Viral Protein
Keywords: viral fusion protein, virus attachment and entry, Viral Protein
Deposited on 2013-12-19, released 2014-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.166
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:1331560]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot R9U684 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d4o5na1, d4o5na2
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:1331560]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4o5nb_
  • Heterogens: NAG, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o5nA (A:)
    adpgatlclghhavpngtivktitndqievtnatelvqnssigeicdsphqildgenctl
    idallgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfn
    wtgvtqngtssacirrsnnsffsrlnwlthlnfkypalnvtmpnneqfdklyiwgvhhpg
    tdkdqiflyaqssgritvstkrsqqavipnigsrprirnipsrisiywtivkpgdillin
    stgnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacp
    ryvkqstlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o5nA (A:)
    pgatlclghhavpngtivktitndqievtnatelvqnssigeicdsphqildgenctlid
    allgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwt
    gvtqngtssacirrsnnsffsrlnwlthlnfkypalnvtmpnneqfdklyiwgvhhpgtd
    kdqiflyaqssgritvstkrsqqavipnigsrprirnipsrisiywtivkpgdillinst
    gnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpry
    vkqstlklatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o5nB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegrgqaadlkstqaaidqingklnrligktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqikgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o5nB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegrgqaadlkstqaaidqingklnrligktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi