PDB entry 4o58

View 4o58 on RCSB PDB site
Description: Crystal structure of broadly neutralizing antibody F045-092 in complex with A/Victoria/3/1975 (H3N2) influenza hemagglutinin
Class: viral protein/immune system
Keywords: immunoglobulin, virus attachment and entry, immune recognition, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2013-12-19, released 2014-04-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-05-14, with a file datestamp of 2014-05-09.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.18
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:392809]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03435 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.05: d4o58a_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:392809]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4o58b_
  • Chain 'H':
    Compound: Fab F045-092 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4O58 (0-End)
    • Uniprot S6C4S0
  • Chain 'L':
    Compound: Fab F045-092 light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGL@, IGLC2
    Database cross-references and differences (RAF-indexed):
    • PDB 4O58 (0-115)
    • Uniprot P0CG05 (116-End)
    Domains in SCOPe 2.05: d4o58l1, d4o58l2
  • Heterogens: NAG, SO4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o58A (A:)
    adpgatlclghhavpngtlvktitndqievtnatelvqssstgkicnnphrildginctl
    idallgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfn
    wtgvtqnggssackrgpdsgffsrlnwlyksgstypvqnvtmpnndnsdklyiwgvhhps
    tdkeqtnlyvqasgkvtvstkrsqqtiipnvgsrpwvrglssrisiywtivkpgdilvin
    sngnliaprgyfkmrtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacp
    kyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o58A (A:)
    pgatlclghhavpngtlvktitndqievtnatelvqssstgkicnnphrildginctlid
    allgdphcdgfqnekwdlfverskafsncypydvpdyaslrslvassgtlefinegfnwt
    gvtqnggssackrgpdsgffsrlnwlyksgstypvqnvtmpnndnsdklyiwgvhhpstd
    keqtnlyvqasgkvtvstkrsqqtiipnvgsrpwvrglssrisiywtivkpgdilvinsn
    gnliaprgyfkmrtgkssimrsdapigtcssecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4o58B (B:)
    gifgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqikgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o58B (B:)
    gifgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfq
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4o58L (L:)
    qsvltqppsasgtpgqsvtiscsgsrsniggntvnwyqhlpgmapklliyssnqrssgvp
    drfsgsksgtsaslaisglqseddadyycaswddslngvvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o58L (L:)
    qsvltqppsasgtpgqsvtiscsgsrsniggntvnwyqhlpgmapklliyssnqrssgvp
    drfsgsksgtsaslaisglqseddadyycaswddslngvvfgggtkltvlgqpkaapsvt
    lfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaass
    ylsltpeqwkshrsyscqvthegstvektvapt