PDB entry 4o56

View 4o56 on RCSB PDB site
Description: Structure of PLK1 in complex with peptide
Deposited on 2013-12-19, released 2014-12-24
The last revision was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.143
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PLK1
    Species: Homo sapiens [TaxId:9606]
    Gene: PLK1, PLK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53350 (7-243)
      • expression tag (0-6)
  • Chain 'B':
    Compound: synthetic peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 4O56 (0-7)
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4o56A (A:)
lgspgiqgevvdchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysd
kyglgyqlcdnsvgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitll
kyfrnymsehllkaganitpregdelarlpylrtwfrtrsaiilhlsngsvqinffqdht
klilcplmaavtyidekrdfrtyrlslleeygcckelasrlryartmvdkllssrsasnr
lkas

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >4o56B (B:)
gpmtstpk