PDB entry 4o52

View 4o52 on RCSB PDB site
Description: Crystal Structure of Trichomonas vaginalis Triosephosphate Isomerase Ile45-Val mutant (Tvag_497370)
Class: isomerase
Keywords: TIM barrel, isomerase
Deposited on 2013-12-19, released 2014-12-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-12-24, with a file datestamp of 2014-12-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.169
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_497370
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2EGX9 (Start-251)
      • engineered mutation (44)
    Domains in SCOPe 2.05: d4o52a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4o52A (A:)
    mrtffvggnwkanpktveeaekliemlngakvegnvevvvaapfvflptlqqklrkdwkv
    saenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfalengm
    kiiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastq
    daqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggaslepg
    finivnsnvhsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4o52A (A:)
    rtffvggnwkanpktveeaekliemlngakvegnvevvvaapfvflptlqqklrkdwkvs
    aenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfalengmk
    iiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastqd
    aqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggaslepgf
    inivnsnvhsk