PDB entry 4o50

View 4o50 on RCSB PDB site
Description: Crystal Structure of Trichomonas vaginalis Triosephosphate Isomerase Ile45-Ala mutant (Tvag_497370)
Class: isomerase
Keywords: TIM barrel, isomerase
Deposited on 2013-12-19, released 2014-12-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trichomonas vaginalis [TaxId:5722]
    Gene: TVAG_497370
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2EGX9 (0-251)
      • engineered mutation (44)
    Domains in SCOPe 2.08: d4o50a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4o50A (A:)
mrtffvggnwkanpktveeaekliemlngakvegnvevvvaapfaflptlqqklrkdwkv
saenvftkpngaftgevtvpmiksfgiewtilghserrdilkeddeflaakakfalengm
kiiyccgehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastq
daqemckvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggaslepg
finivnsnvhsk